1. 25 Aug, 2004 11 commits
    • David Odin's avatar
      app/widgets/gimppreview-popup.c renamed these files... · e91187ae
      David Odin authored
      * app/widgets/gimppreview-popup.c
      * app/widgets/gimppreview-popup.h: renamed these files...
      * app/widgets/gimpview-popup.c
      * app/widgets/gimpview-popup.h: .. to these files, and changed the
        GimpPreviewPopup type to GimpViewPopup.
      * app/widgets/gimppreviewrenderer.c
      * app/widgets/gimppreviewrenderer.h: renamed these files...
      * app/widgets/gimpviewrenderer.c
      * app/widgets/gimpviewrenderer.h: .. to these files, and changed
        GimpPreviewRenderer to GimpViewRenderer.
      This is the second step of the great Preview->View renaming process.
      * app/display/gimpdisplayshell-layer-select.c
      * app/display/gimpnavigationeditor.c
      * app/widgets/Makefile.am
      * app/widgets/gimpbrushfactoryview.c
      * app/widgets/gimpbufferview.c
      * app/widgets/gimpcellrendererviewable.c
      * app/widgets/gimpcellrendererviewable.h
      * app/widgets/gimpcomponenteditor.c
      * app/widgets/gimpcontainerbox.c
      * app/widgets/gimpcontainercombobox.c
      * app/widgets/gimpcontainereditor.c
      * app/widgets/gimpcontainerentry.c
      * app/widgets/gimpcontainergridview.c
      * app/widgets/gimpcontainerpopup.c
      * app/widgets/gimpcontainertreeview-dnd.c
      * app/widgets/gimpcontainertreeview.c
      * app/widgets/gimpcontainerview.c
      * app/widgets/gimpdatafactoryview.c
      * app/widgets/gimpitemtreeview.c
      * app/widgets/gimplayertreeview.c
      * app/widgets/gimpnavigationpreview.c
      * app/widgets/gimppatternfactoryview.c
      * app/widgets/gimppreviewrenderer-utils.c
      * app/widgets/gimppreviewrendererbrush.c
      * app/widgets/gimppreviewrendererbrush.h
      * app/widgets/gimppreviewrendererdrawable.c
      * app/widgets/gimppreviewrendererdrawable.h
      * app/widgets/gimppreviewrenderergradient.c
      * app/widgets/gimppreviewrenderergradient.h
      * app/widgets/gimppreviewrendererimage.c
      * app/widgets/gimppreviewrendererimage.h
      * app/widgets/gimppreviewrendererimagefile.c
      * app/widgets/gimppreviewrendererimagefile.h
      * app/widgets/gimppreviewrendererlayer.c
      * app/widgets/gimppreviewrenderervectors.c
      * app/widgets/gimpselectioneditor.c
      * app/widgets/gimptemplateview.c
      * app/widgets/gimptooloptionseditor.c
      * app/widgets/gimptoolview.c
      * app/widgets/gimpview.c
      * app/widgets/gimpview.h
      * app/widgets/gimpviewablebutton.c
      * app/widgets/widgets-enums.h
      * app/widgets/widgets-types.h: Modified accordingly.
    • Sven Neumann's avatar
      app/app-docs.sgml app/app-sections.txt updated. · e6a034fc
      Sven Neumann authored
      2004-08-25  Sven Neumann  <sven@gimp.org>
      	* app/app-docs.sgml
      	* app/app-sections.txt
      	* app/app.types: updated.
    • Sven Neumann's avatar
      stop adding message boxes and redirect messages to stderr if there are too · 8b6970ec
      Sven Neumann authored
      2004-08-25  Sven Neumann  <sven@gimp.org>
      	* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
      	adding message boxes and redirect messages to stderr if there are
      	too many messages.
    • William Skaggs's avatar
      Bill Skaggs <weskaggs@primate.ucdavis.edu> · c92a3862
      William Skaggs authored
      	* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
    • Sven Neumann's avatar
      updated. · da66a8db
      Sven Neumann authored
      2004-08-25  Sven Neumann  <sven@gimp.org>
      	* POTFILES.in: updated.
    • Sven Neumann's avatar
      added gimp_message_box_repeat(). · 80531ec9
      Sven Neumann authored
       2004-08-25  Sven Neumann  <sven@gimp.org>
      	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().
      	* app/widgets/Makefile.am
      	* app/widgets/widgets-types.h
      	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
      	GimpMessageBox for each message added. Fixes bug #92604.
      	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
      	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.
      	* app/gui/dialogs-constructors.[ch]
      	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.
      	* app/gui/gui-vtable.c (gui_message): use the new error dialog.
      	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
      	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
      	when being called with a NULL domain.
    • David Odin's avatar
      eradicate some more previews in favor of views. · 54fa5a0a
      David Odin authored
      * app/display/gimpnavigationeditor.[ch]: eradicate some more previews
        in favor of views.
    • William Skaggs's avatar
      Bill Skaggs <weskaggs@primate.ucdavis.edu> · 856b87b1
      William Skaggs authored
      	* devel-docs/Makefile.am: added ggr.txt to list.
    • William Skaggs's avatar
      Bill Skaggs <weskaggs@primate.ucdavis.edu> · 21ba16c6
      William Skaggs authored
      	* devel-docs/ggr.txt: added new file decribing the ggr
      	(Gimp gradient) file format.
    • David Odin's avatar
      app/display/gimpnavigationview.c renamed these files to... · f168881c
      David Odin authored
      * app/display/gimpnavigationview.c
      * app/display/gimpnavigationview.h: renamed these files to...
      * app/display/gimpnavigationeditor.c
      * app/display/gimpnavigationeditor.h: ... these files, and of course
        changed GimpNavigationView to GimpNavigationEditor since it is really
        inherited from GimpEditor anyway.
      This will leave the gimp_navigation_view namespace for the renaming
      from gimp_navigation_preview.
      * app/display/Makefile.am
      * app/display/display-types.h
      * app/display/gimpdisplayshell-callbacks.c
      * app/gui/dialogs-constructors.c: Changed accordlingly.
    • Michael Natterer's avatar
      print bad '%' sequences literally instead of warning (g_warning() is for · da34232a
      Michael Natterer authored
      2004-08-25  Michael Natterer  <mitch@gimp.org>
      	* app/display/gimpdisplayshell-title.c
      	(gimp_display_shell_format_title): print bad '%' sequences
      	literally instead of warning (g_warning() is for programming
      	errors only and must never be triggered by bad or intermediate
      	user input). Fixes bug #150676
  2. 24 Aug, 2004 4 commits
    • Sven Neumann's avatar
      put the icon to the right for RTL layouts. · d52d54fe
      Sven Neumann authored
      2004-08-24  Sven Neumann  <sven@gimp.org>
      	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
      	* app/display/gimpdisplayshell-close.c
      	* app/gui/quit-dialog.c: use a GimpMessageBox.
    • Roman Joost's avatar
      updated and removed fuzzy strings · f86f3282
      Roman Joost authored
      2004-08-24  Roman Joost	<romanofski@gimp.org>
      	* de.po: updated and removed fuzzy strings
    • Sven Neumann's avatar
      added API to change the labels. Modeled after the proposed new API for · 6939d7ab
      Sven Neumann authored
      2004-08-24  Sven Neumann  <sven@gimp.org>
      	* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
      	Modeled after the proposed new API for GtkMessageDialog.
      	* app/widgets/gimpwidgets-utils.c: changed accordingly.
    • David Odin's avatar
      app/widgets/gimppreview.c renamed these two files to... · cddf61a3
      David Odin authored
      * app/widgets/gimppreview.c
      * app/widgets/gimppreview.h: renamed these two files to...
      * app/widgets/gimpview.c
      * app/widgets/gimpview.h: ... these files.
      Also renamed GimpPreview to GimpView.
      This is the first step of the great Preview->View renaming process.
      * app/actions/palettes-commands.c
      * app/display/gimpdisplayshell-layer-select.c
      * app/display/gimpnavigationview.c
      * app/gui/palette-import-dialog.c
      * app/tools/gimppaintoptions-gui.c
      * app/widgets/Makefile.am
      * app/widgets/gimpaction.c
      * app/widgets/gimpactiongroup.c
      * app/widgets/gimpbrusheditor.c
      * app/widgets/gimpbufferview.c
      * app/widgets/gimpcontainerbox.c
      * app/widgets/gimpcontainergridview.c
      * app/widgets/gimpcontainergridview.h
      * app/widgets/gimpdevicestatus.c
      * app/widgets/gimpdnd.c
      * app/widgets/gimpdockbook.c
      * app/widgets/gimpfiledialog.c
      * app/widgets/gimpgradienteditor.c
      * app/widgets/gimpnavigationpreview.c
      * app/widgets/gimpnavigationpreview.h
      * app/widgets/gimppaletteeditor.c
      * app/widgets/gimppreview-popup.c
      * app/widgets/gimppropwidgets.c
      * app/widgets/gimpselectioneditor.c
      * app/widgets/gimpthumbbox.c
      * app/widgets/gimptoolbox-image-area.c
      * app/widgets/gimptoolbox-indicator-area.c
      * app/widgets/gimptooloptionseditor.c
      * app/widgets/gimpviewabledialog.c
      * app/widgets/widgets-types.h: changed accordingly.
  3. 23 Aug, 2004 5 commits
  4. 22 Aug, 2004 3 commits
    • Sven Neumann's avatar
      app/tools/Makefile.am added gimp_tool_motion_constrain(), · 0c2d88e9
      Sven Neumann authored
      2004-08-22  Sven Neumann  <sven@gimp.org>
      	* app/tools/Makefile.am
      	* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),
      	* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().
      	* app/tools/gimppainttool.c: changed accordingly.
      	* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
      	instead of duplicating that functionality.
      	* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
      	instead of implementing completely different constraints.
    • Simon Budig's avatar
      Implemented the ellipse basic shape differently to avoid possible rounding · e86dff66
      Simon Budig authored
      2004-08-22  Simon Budig  <simon@gimp.org>
      	* app/vectors/gimpbezierstroke.c: Implemented the ellipse basic
      	shape differently to avoid possible rounding issues with
      	the _arcto () command.
      	* app/vectors/gimpvectors-import.c: properly close the rounded
    • Sven Neumann's avatar
      support optional center coordinates for the "rotate" transformations. · d6a016b4
      Sven Neumann authored
      2004-08-21  Sven Neumann  <sven@gimp.org>
      	* app/vectors/gimpvectors-import.c (parse_svg_transform): support
      	optional center coordinates for the "rotate" transformations.
      	(parse_svg_transform): apply transformations in reverse order. The
      	SVG spec is rather confusing here.
  5. 21 Aug, 2004 6 commits
  6. 20 Aug, 2004 4 commits
  7. 19 Aug, 2004 3 commits
  8. 18 Aug, 2004 3 commits
    • Sven Neumann's avatar
      no need to set a size_request here. · 0620ee06
      Sven Neumann authored
      2004-08-18  Sven Neumann  <sven@gimp.org>
      	* app/gui/color-notebook.c: no need to set a size_request here.
      	* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.
      	* libgimpwidgets/gimpcolorscales.c
      	* modules/colorsel_cmyk.c: don't set a minimum width on the color
      	scales. Improves behaviour for narrow color dockables.
    • Sven Neumann's avatar
      fixed crashes that occured with small sizes, some code cleanups and a · d5cd7ae3
      Sven Neumann authored
      2004-08-18  Sven Neumann  <sven@gimp.org>
      	* modules/colorsel_triangle.c: fixed crashes that occured with
      	small sizes, some code cleanups and a simple optimization.
    • Sven Neumann's avatar
      define GIMP_HELP_DOCK_SEPARATOR. · 2d5ee448
      Sven Neumann authored
      2004-08-18  Sven Neumann  <sven@gimp.org>
      	* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.
      	* app/widgets/gimpdock.c
      	* app/widgets/gimpdockable.c: help-ids are never used directly,
      	use the defines from app/widgets/gimphelp-ids.h instead.
  9. 17 Aug, 2004 1 commit