- 26 Aug, 2004 5 commits
-
-
David Odin authored
* app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
-
Sven Neumann authored
2004-08-26 Sven Neumann <sven@gimp.org> * app/sanity.c (sanity_check_filename_encoding): try to convert the result of gimp_directory() to UTF-8 and bail out with a moderately helpful error message if this conversion fails. Works around bug #150917. Also marked these strings for translation.
-
Sven Neumann authored
2004-08-26 Sven Neumann <sven@gimp.org> * app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush as the default tool as suggested in bug #151091.
-
Sven Neumann authored
2004-08-26 Sven Neumann <sven@gimp.org> * de.po: minor update.
-
David Odin authored
* app/widgets/gimppreview-popup.c * app/widgets/gimppreview-popup.h * app/widgets/gimppreviewrenderer.c * app/widgets/gimppreviewrenderer.h: really removed these files from cvs.
-
- 25 Aug, 2004 12 commits
-
-
Manish Singh authored
2004-08-25 Manish Singh <yosh@gimp.org> * plug-ins/common/gifload.c: Guard against bogus logical screen dimensions. Fixes bug #151053.
-
David Odin authored
* app/widgets/gimppreview-popup.c * app/widgets/gimppreview-popup.h: renamed these files... * app/widgets/gimpview-popup.c * app/widgets/gimpview-popup.h: .. to these files, and changed the GimpPreviewPopup type to GimpViewPopup. * app/widgets/gimppreviewrenderer.c * app/widgets/gimppreviewrenderer.h: renamed these files... * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: .. to these files, and changed GimpPreviewRenderer to GimpViewRenderer. This is the second step of the great Preview->View renaming process. * app/display/gimpdisplayshell-layer-select.c * app/display/gimpnavigationeditor.c * app/widgets/Makefile.am * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpcellrendererviewable.h * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpcontainertreeview-dnd.c * app/widgets/gimpcontainertreeview.c * app/widgets/gimpcontainerview.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimpnavigationpreview.c * app/widgets/gimppatternfactoryview.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimpselectioneditor.c * app/widgets/gimptemplateview.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.c * app/widgets/gimpview.c * app/widgets/gimpview.h * app/widgets/gimpviewablebutton.c * app/widgets/widgets-enums.h * app/widgets/widgets-types.h: Modified accordingly.
-
Sven Neumann authored
2004-08-25 Sven Neumann <sven@gimp.org> * app/app-docs.sgml * app/app-sections.txt * app/app.types: updated.
-
Sven Neumann authored
2004-08-25 Sven Neumann <sven@gimp.org> * app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop adding message boxes and redirect messages to stderr if there are too many messages.
-
William Skaggs authored
* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
-
Sven Neumann authored
2004-08-25 Sven Neumann <sven@gimp.org> * POTFILES.in: updated.
-
Sven Neumann authored
2004-08-25 Sven Neumann <sven@gimp.org> * app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat(). * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimperrordialog.[ch]: added new dialog that adds a new GimpMessageBox for each message added. Fixes bug #92604. * app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box() functionality. * app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog. * app/gui/dialogs-constructors.[ch] * app/gui/dialogs.c: manage GimpErrorDialog as singleton. * app/gui/gui-vtable.c (gui_message): use the new error dialog. * app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL domain. * app/widgets/gimperrorconsole.c (gimp_error_console_add): fail when being called with a NULL domain.
-
David Odin authored
* app/display/gimpnavigationeditor.[ch]: eradicate some more previews in favor of views.
-
William Skaggs authored
* devel-docs/Makefile.am: added ggr.txt to list.
-
William Skaggs authored
* devel-docs/ggr.txt: added new file decribing the ggr (Gimp gradient) file format.
-
David Odin authored
* app/display/gimpnavigationview.c * app/display/gimpnavigationview.h: renamed these files to... * app/display/gimpnavigationeditor.c * app/display/gimpnavigationeditor.h: ... these files, and of course changed GimpNavigationView to GimpNavigationEditor since it is really inherited from GimpEditor anyway. This will leave the gimp_navigation_view namespace for the renaming from gimp_navigation_preview. * app/display/Makefile.am * app/display/display-types.h * app/display/gimpdisplayshell-callbacks.c * app/gui/dialogs-constructors.c: Changed accordlingly.
-
Michael Natterer authored
2004-08-25 Michael Natterer <mitch@gimp.org> * app/display/gimpdisplayshell-title.c (gimp_display_shell_format_title): print bad '%' sequences literally instead of warning (g_warning() is for programming errors only and must never be triggered by bad or intermediate user input). Fixes bug #150676
-
- 24 Aug, 2004 4 commits
-
-
Sven Neumann authored
2004-08-24 Sven Neumann <sven@gimp.org> * app/widgets/gimpmessagebox.c: put the icon to the right for RTL layouts. * app/display/gimpdisplayshell-close.c * app/gui/quit-dialog.c: use a GimpMessageBox.
-
Roman Joost authored
2004-08-24 Roman Joost <romanofski@gimp.org> * de.po: updated and removed fuzzy strings
-
Sven Neumann authored
2004-08-24 Sven Neumann <sven@gimp.org> * app/widgets/gimpmessagebox.[ch]: added API to change the labels. Modeled after the proposed new API for GtkMessageDialog. * app/widgets/gimpwidgets-utils.c: changed accordingly.
-
David Odin authored
* app/widgets/gimppreview.c * app/widgets/gimppreview.h: renamed these two files to... * app/widgets/gimpview.c * app/widgets/gimpview.h: ... these files. Also renamed GimpPreview to GimpView. This is the first step of the great Preview->View renaming process. * app/actions/palettes-commands.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpnavigationview.c * app/gui/palette-import-dialog.c * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpaction.c * app/widgets/gimpactiongroup.c * app/widgets/gimpbrusheditor.c * app/widgets/gimpbufferview.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainergridview.h * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.c * app/widgets/gimpdockbook.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpnavigationpreview.c * app/widgets/gimpnavigationpreview.h * app/widgets/gimppaletteeditor.c * app/widgets/gimppreview-popup.c * app/widgets/gimppropwidgets.c * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.c * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpviewabledialog.c * app/widgets/widgets-types.h: changed accordingly.
-
- 23 Aug, 2004 5 commits
-
-
Sven Neumann authored
2004-08-24 Sven Neumann <sven@gimp.org> * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox. * app/widgets/gimpwidgets-utils.c: use it for message dialogs.
-
Sven Neumann authored
2004-08-24 Sven Neumann <sven@gimp.org> * Makefile.am (tips_POFILES): added pa.po (Punjabi).
-
Amanpreet Singh Alam authored
-
Sven Neumann authored
2004-08-23 Sven Neumann <sven@gimp.org> * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset the filename if gtk_file_chooser_set_uri() failed. * app/actions/file-commands.c * app/gui/file-save-dialog.c: trivial cleanups. * app/widgets/gimpwidgets-utils.c: removed an unused extern variable declaration.
-
David Odin authored
* app/tools/tools-utils.c: fixed a typo that broke the build.
-
- 22 Aug, 2004 3 commits
-
-
Sven Neumann authored
2004-08-22 Sven Neumann <sven@gimp.org> * app/tools/Makefile.am * app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(), * app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain(). * app/tools/gimppainttool.c: changed accordingly. * app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain() instead of duplicating that functionality. * app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain() instead of implementing completely different constraints.
-
Simon Budig authored
2004-08-22 Simon Budig <simon@gimp.org> * app/vectors/gimpbezierstroke.c: Implemented the ellipse basic shape differently to avoid possible rounding issues with the _arcto () command. * app/vectors/gimpvectors-import.c: properly close the rounded rectangles.
-
Sven Neumann authored
2004-08-21 Sven Neumann <sven@gimp.org> * app/vectors/gimpvectors-import.c (parse_svg_transform): support optional center coordinates for the "rotate" transformations. (parse_svg_transform): apply transformations in reverse order. The SVG spec is rather confusing here.
-
- 21 Aug, 2004 6 commits
-
-
Sven Neumann authored
-
Sven Neumann authored
2004-08-21 Sven Neumann <sven@gimp.org> * app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed a bug I introduced with my last commit. * app/vectors/gimpvectors-import.c: added support for the basic SVG shape "rect". Fixed handling of SVG lengths in basic shapes.
-
Sven Neumann authored
2004-08-21 Sven Neumann <sven@gimp.org> * app/vectors/gimpbezierstroke.[ch]: added new function gimp_bezier_stroke_new_ellipse() that provides a simple API to create a bezier stroke that represents an ellipse. * app/vectors/gimpvectors-import.c: added support for the basic SVG shapes "circle" and "ellipse".
-
Simon Budig authored
2004-08-21 Simon Budig <simon@gimp.org> * plug-ins/common/gih.c: Fix some GUI issues. Make the relation between the dimension parameter and the rank thingies more clear also changed to a nicer layout.
-
Sven Neumann authored
2004-08-21 Sven Neumann <sven@gimp.org> * app/vectors/gimpvectors-import.c: added support for the basic SVG shapes "polyline" and "polygon".
-
Sven Neumann authored
2004-08-21 Sven Neumann <sven@gimp.org> * app/vectors/gimpvectors-import.c: added support for importing the basic SVG shape "line". Other shapes will follow...
-
- 20 Aug, 2004 4 commits
-
-
Sven Neumann authored
-
Sven Neumann authored
2004-08-21 Sven Neumann <sven@gimp.org> * app/actions/layers-actions.[ch] * app/actions/layers-commands.[ch] * app/widgets/gimplayertreeview.c: added actions to handle layer masks as suggested in bug #150446. * menus/layers-menu.xml: added menu entries for new actions, commented out raise/lower menu entries.
-
Sven Neumann authored
2004-08-20 Sven Neumann <sven@gimp.org> * modules/controller_linux_input.c: declare local function as static.
-
Laurent Dhima authored
-
- 19 Aug, 2004 1 commit
-
-
Sven Neumann authored
-